PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0010ss02220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 211aa    MW: 24522.3 Da    PI: 4.5243
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0010ss02220.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.4e-184289148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg+WT+eEd++lv  v+++G ++W+ Ia+  g++Rt+k+c++rw +yl
  Vang0010ss02220.1 42 RGPWTEEEDLKLVYFVNMFGDRRWDFIAKVSGLNRTGKSCRLRWVNYL 89
                       89********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-203592IPR009057Homeodomain-like
PROSITE profilePS5129423.4013793IPR017930Myb domain
SMARTSM007172.4E-164191IPR001005SANT/Myb domain
PfamPF002491.5E-164289IPR001005SANT/Myb domain
SuperFamilySSF466895.34E-2143115IPR009057Homeodomain-like
CDDcd001672.39E-124489No hitNo description
PROSITE profilePS500904.62390130IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.5E-693116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
LATEKLTMNE HACTTWTGGR IRKLSSEELE EEKKMVQEEM RRGPWTEEED LKLVYFVNMF  60
GDRRWDFIAK VSGLNRTGKS CRLRWVNYLH PDLKRGKLTS QEEHLVMELH SKWGNSAGEE  120
FSLDDIWKDI VLSEDDTIQQ QPLYELQSQE GCNFSSPPAM IYSPSSSWEY NSSHPLWVMD  180
EEESSKMLFP ASSDQYYYSC YEQGNAFLTG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-153312349138MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-153312349138MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-160AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014519116.17e-56PREDICTED: transcription factor MYB59-like
TrEMBLA0A0L9TJQ49e-63A0A0L9TJQ4_PHAAN; Uncharacterized protein
STRINGGLYMA11G15180.67e-46(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43783359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.33e-45myb domain protein 59